PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001481.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 240aa    MW: 27173.7 Da    PI: 6.9868
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001481.1_g00006.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.93.1e-26130178452
                   RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                               +++++++kyF lpi++AAkeL+v+lT+LK++CR+++I+RWPhRkiksl
  Itr_sc001481.1_g00006.1 130 ALEFDEIQKYFGLPITKAAKELKVGLTALKKRCRELNISRWPHRKIKSL 178
                              799********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.12108200IPR003035RWP-RK domain
PfamPF020421.3E-22131178IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MDPTPFNNVV VHPKLENQNA NAAAADWLFF DDYYTNLMAT WEEESGFCES FNNNCGGGVS  60
NILGDLDYDV GDLNVWDYDD PSAAIFQGEE EGRCGSSSGG SNNNNVNDKE TMKRKRKVGS  120
GERCCKKPAA LEFDEIQKYF GLPITKAAKE LKVGLTALKK RCRELNISRW PHRKIKSLTS  180
LIHNIKELGM GNEIEMLEEH KRMVECIPEM ELTERTKKLR QACFKANYKR RKSSLPAPSH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084743.11e-59PREDICTED: protein RKD4
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA121431922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.13e-43RWP-RK domain-containing protein